PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22519.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 305aa    MW: 34594.3 Da    PI: 6.7415
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22519.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.16.2e-082252582154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  KHN22519.1 225 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 258
                 469*****************************87 PP

2ELK29.41.8e-10179200122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++++++++E++
  KHN22519.1 179 ELKHELKQGYKEKIVDIREEIL 200
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.4E-72057IPR005540KNOX1
PfamPF037909.4E-72256IPR005540KNOX1
SMARTSM012565.9E-2767122IPR005541KNOX2
PfamPF037913.1E-2072121IPR005541KNOX2
SMARTSM011886.1E-4179200IPR005539ELK domain
PROSITE profilePS512139.969179199IPR005539ELK domain
PfamPF037896.6E-7179200IPR005539ELK domain
PROSITE profilePS5007111.726199262IPR001356Homeobox domain
SuperFamilySSF466893.64E-16201265IPR009057Homeodomain-like
SMARTSM003894.7E-11201266IPR001356Homeobox domain
CDDcd000866.36E-12202263No hitNo description
Gene3DG3DSA:1.10.10.602.6E-25206263IPR009057Homeodomain-like
PfamPF059207.5E-18219258IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MVEHADLKDG GGDAVSWQIG RCKTEILQHP LYEQLLRIAT PVDQLPRIDA QLAQSQNVVA  60
KYAAFGHNNI VADDKELDQF MSHYVLLLCS FKEQLQQHVR VHAMEAVMAC WELEQSLQSL  120
TGVSPGEGTG ATMSDDENDQ VDSDANLFDC SFDGADSMGF GPLVPTESER SLMERVRQEL  180
KHELKQGYKE KIVDIREEIL RKRRAGKLPG DTTSVLKAWW QSHSKWPYPT EEDKARLVQE  240
TGLQLKQINN WFINQRKRNW HSNPSTSTAL KSKRKRVKAD QGANIGLLML KGQQIVHIVL  300
VMLHN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12202266872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1255275RKRNWHSNPSTSTALKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311740.0KT031174.1 Glycine max clone HN_CCL_151 homeodomain/HOMEOBOX transcription factor (Glyma17g32980.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006601171.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotP480001e-167KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0B2QQU10.0A0A0B2QQU1_GLYSO; Homeobox protein knotted-1-like 3
STRINGGLYMA17G32980.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-169KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]